TIPIN purified MaxPab rabbit polyclonal antibody (D01P)
  • TIPIN purified MaxPab rabbit polyclonal antibody (D01P)

TIPIN purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00054962-D01P
TIPIN purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TIPIN protein.
Información adicional
Size 100 ug
Gene Name TIPIN
Gene Alias FLJ20516
Gene Description TIMELESS interacting protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MLEPQENGVIDLPDYEHVEDETFPPFPPPASPERQDGEGTEPDEESGNGAPVPVPPKRTVKRNIPKLDAQRLISERGLPALRHVFDKAKFKGKGHEAEDLKMLIRHMEHWAHRLFPKLQFEDFIDRVEYLGSKKEVQTCLKRIRLDLPILHEDFVSNNDEVAENNEHDVTSTELDPFLTNLSESEMFASELSRSLTEEQQQRIERNKQLALERRQAKLLSNSQTLGNDMLMNTPRAHTVEEVNTDEDQKEESNGL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TIPIN (AAH00870.1, 1 a.a. ~ 301 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54962

Enviar uma mensagem


TIPIN purified MaxPab rabbit polyclonal antibody (D01P)

TIPIN purified MaxPab rabbit polyclonal antibody (D01P)