SSH3 purified MaxPab rabbit polyclonal antibody (D01P)
  • SSH3 purified MaxPab rabbit polyclonal antibody (D01P)

SSH3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00054961-D01P
SSH3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SSH3 protein.
Información adicional
Size 100 ug
Gene Name SSH3
Gene Alias FLJ10928|FLJ20515|SSH-3
Gene Description slingshot homolog 3 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MALVTVSRSPPGSGASTPVGPWDQAVQRRSRLQRRQSFAVLRGAVLGLQDGGDNDDAAEASSEPTEKAPSEEELHGDQTDFGQGSQSPQKQEEQRQHLHLMVQLLRPQDDIRLAAQLEAPRPPRLRYLLVVSTREGEGLSQDETVLLGVDFPDSSSPSCTLGLVLPLWSDTQVYLDGDGGFSVTSGGQSRIFKPISIQTMWATLQVLHQACEAALGSGLVPGGSALTWASHYQERLNSEQSCLNEWTAMADLESL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SSH3 (AAH07709.1, 1 a.a. ~ 659 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54961

Enviar uma mensagem


SSH3 purified MaxPab rabbit polyclonal antibody (D01P)

SSH3 purified MaxPab rabbit polyclonal antibody (D01P)