ODAM purified MaxPab mouse polyclonal antibody (B01P)
  • ODAM purified MaxPab mouse polyclonal antibody (B01P)

ODAM purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054959-B01P
ODAM purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ODAM protein.
Información adicional
Size 50 ug
Gene Name ODAM
Gene Alias APIN|FLJ20513
Gene Description odontogenic, ameloblast asssociated
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGYIPQLAEPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYLQKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQTITPELPEEKDKTDSLREP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ODAM (AAH17796.1, 1 a.a. ~ 153 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54959

Enviar uma mensagem


ODAM purified MaxPab mouse polyclonal antibody (B01P)

ODAM purified MaxPab mouse polyclonal antibody (B01P)