LPCAT2 purified MaxPab mouse polyclonal antibody (B01P)
  • LPCAT2 purified MaxPab mouse polyclonal antibody (B01P)

LPCAT2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054947-B01P
LPCAT2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LPCAT2 protein.
Información adicional
Size 50 ug
Gene Name LPCAT2
Gene Alias AYTL1|DKFZp686H22112|FLJ20481|LysoPAFAT
Gene Description lysophosphatidylcholine acyltransferase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MSRCAQAAEVAATVPGAGVGNVGLRPPMVPRQASFFPPPVPNPFVQQTQIGSARRVQIVLLGIILLPIRVLLVALILLLAWPFAAISTVCCPEKLTHPITGWRRKITQTALKFLGRAMFFSMGFIVAVKGKIASPLEAPVFVAAPHSTFFDGIACVVAGLPSMVSRNENAQVPLIGRLLRAVQPVLVSRVDPDSRKNTINEIIKRTTSGGEWPQILVFPEGTCTNRSCLITFKPGAFIPGVPVQPVLLRYPNKLD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LPCAT2 (NP_060309.2, 1 a.a. ~ 544 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54947

Enviar uma mensagem


LPCAT2 purified MaxPab mouse polyclonal antibody (B01P)

LPCAT2 purified MaxPab mouse polyclonal antibody (B01P)