SOHLH2 purified MaxPab rabbit polyclonal antibody (D01P)
  • SOHLH2 purified MaxPab rabbit polyclonal antibody (D01P)

SOHLH2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00054937-D01P
SOHLH2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SOHLH2 protein.
Información adicional
Size 100 ug
Gene Name SOHLH2
Gene Alias FLJ20449|TEB1|bA121N13.2
Gene Description spermatogenesis and oogenesis specific basic helix-loop-helix 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MASSIICQEHCQISGQAKIDILLVGDVTVGYLADTVQKLFANIAEVTITISDTKEAAALLDDCIFNMVLLKVPSSLSAEELEAIKLIRFGKKKNTHSLFVFIIPENFKGCISGHGMDIALTEPLTMEKMSNVVKYWTTCPSNTVKTENATGPEELGLPLQRSYSEHLGYFPTDLFACSESLRNGNGLELNASLSEFEKNKKISLLHSSKEKLRRLYRKHSSFCFW
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SOHLH2 (AAH25383.1, 1 a.a. ~ 225 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54937

Enviar uma mensagem


SOHLH2 purified MaxPab rabbit polyclonal antibody (D01P)

SOHLH2 purified MaxPab rabbit polyclonal antibody (D01P)