DUSP23 purified MaxPab rabbit polyclonal antibody (D01P)
  • DUSP23 purified MaxPab rabbit polyclonal antibody (D01P)

DUSP23 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00054935-D01P
DUSP23 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DUSP23 protein.
Información adicional
Size 100 ug
Gene Name DUSP23
Gene Alias DUSP25|FLJ20442|LDP-3|MOSP|RP11-190A12.1|VHZ
Gene Description dual specificity phosphatase 23
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DUSP23 (NP_060293.2, 1 a.a. ~ 150 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54935

Enviar uma mensagem


DUSP23 purified MaxPab rabbit polyclonal antibody (D01P)

DUSP23 purified MaxPab rabbit polyclonal antibody (D01P)