RHBDL2 monoclonal antibody (M02), clone 2H1
  • RHBDL2 monoclonal antibody (M02), clone 2H1

RHBDL2 monoclonal antibody (M02), clone 2H1

Ref: AB-H00054933-M02
RHBDL2 monoclonal antibody (M02), clone 2H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RHBDL2.
Información adicional
Size 100 ug
Gene Name RHBDL2
Gene Alias MGC16997|RRP2
Gene Description rhomboid, veinlet-like 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MAAVHDLEMESMNLNMGREMKEELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRGTYLERANCFPPP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RHBDL2 (NP_060291.2, 1 a.a. ~ 72 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54933
Clone Number 2H1
Iso type IgG2b Kappa

Enviar uma mensagem


RHBDL2 monoclonal antibody (M02), clone 2H1

RHBDL2 monoclonal antibody (M02), clone 2H1