LUZP5 polyclonal antibody (A01)
  • LUZP5 polyclonal antibody (A01)

LUZP5 polyclonal antibody (A01)

Ref: AB-H00054892-A01
LUZP5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LUZP5.
Información adicional
Size 50 uL
Gene Name NCAPG2
Gene Alias CAP-G2|FLJ20311|LUZP5|MTB|hCAP-G2
Gene Description non-SMC condensin II complex, subunit G2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TKTGADVCRLWRIHQALYCFDYDLEESGEIKDMLLECFININYIKKEEGRRFLSCLFNWNINFIKMIHGTIKNQLQGLQKSLMVYIAEIYFRAWKKAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LUZP5 (NP_060230, 177 a.a. ~ 274 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54892

Enviar uma mensagem


LUZP5 polyclonal antibody (A01)

LUZP5 polyclonal antibody (A01)