RP11-35N6.1 purified MaxPab mouse polyclonal antibody (B01P)
  • RP11-35N6.1 purified MaxPab mouse polyclonal antibody (B01P)

RP11-35N6.1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054886-B01P
RP11-35N6.1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RP11-35N6.1 protein.
Información adicional
Size 50 ug
Gene Name RP11-35N6.1
Gene Alias MGC26189|PRG-3
Gene Description plasticity related gene 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAVGNNTQRSYSIIPCFIFVELVIMAGTVLLAYYFECTDTFQVHIQGFFCQDGDLMKPYPGTEEESFITPLVLYCVLAATPTAIIFIGEISMYFIKSTRESLIAQEKTILTGECCYLNPLLRRIIRFTGVFAFGLFATDIFVNAGQVVTGHLTPYFLTVCKPNYTSADCQAHHQFINNGNICTGDLEVIEKARRSFPSKHAALSIYSALYATMYITSTIKTKSSRLAKPVLCLGTLCTAFLTGLNRVSEYRNHCS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RP11-35N6.1 (NP_060223, 1 a.a. ~ 325 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54886

Enviar uma mensagem


RP11-35N6.1 purified MaxPab mouse polyclonal antibody (B01P)

RP11-35N6.1 purified MaxPab mouse polyclonal antibody (B01P)