BCOR polyclonal antibody (A01)
  • BCOR polyclonal antibody (A01)

BCOR polyclonal antibody (A01)

Ref: AB-H00054880-A01
BCOR polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BCOR.
Información adicional
Size 50 uL
Gene Name BCOR
Gene Alias ANOP2|FLJ20285|FLJ38041|KIAA1575|MAA2|MCOPS2|MGC131961|MGC71031
Gene Description BCL6 co-repressor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq RRFRKRPEPSSDYDLSPAKQEPKPFDRLQQLLPASQSTQLPCSSSPQETTQSRPMPPEARRLIVNKNAGETLLQRAARLGYEEVVLYCLENKICDVNHRD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BCOR (NP_060215, 1361 a.a. ~ 1460 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54880

Enviar uma mensagem


BCOR polyclonal antibody (A01)

BCOR polyclonal antibody (A01)