C9orf39 polyclonal antibody (A01)
  • C9orf39 polyclonal antibody (A01)

C9orf39 polyclonal antibody (A01)

Ref: AB-H00054875-A01
C9orf39 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant C9orf39.
Información adicional
Size 50 uL
Gene Name CNTLN
Gene Alias C9orf101|C9orf39|FLJ20276|FLJ25636|RP11-340N12.1|bA340N12.1
Gene Description centlein, centrosomal protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QNDVHVVRRQIRELKKMKKNRDACKTSTHKAQTLAASILNISRSDLEEILDTEDQVEIEKTKIDAENDKEWMLYIQKLLEGQSLALSPRLKCNGAIMAHQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C9orf39 (NP_060208, 971 a.a. ~ 1070 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54875

Enviar uma mensagem


C9orf39 polyclonal antibody (A01)

C9orf39 polyclonal antibody (A01)