CC2D1A purified MaxPab mouse polyclonal antibody (B01P)
  • CC2D1A purified MaxPab mouse polyclonal antibody (B01P)

CC2D1A purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054862-B01P
CC2D1A purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CC2D1A protein.
Información adicional
Size 50 ug
Gene Name CC2D1A
Gene Alias FLJ20241|FLJ41160|FREUD-1|Freud-1/Aki1|MRT3
Gene Description coiled-coil and C2 domain containing 1A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IHC-P,IF
Immunogen Prot. Seq MHKRKGPPGPPGRGAAAARQLGLLVDLSPDGLMIPEDGANDEELEAEFLALVGGQPPALEKLKGKGPLPMEAIEKMASLCMRDPDEDEEEGTDEDDLEADDDLLAELNEVLGEEQKASETPPPVAQPKPEAPHPGLETTLQERLALYQTAIESARQAGDSAKMRRYDRGLKTLENLLASIRKGNAIDEADIPPPVAIGKGPASTPTYSPAPTQPAPRIASAPEPRVTLEGPSATAPASSPGLAKPQMPPGPCSPG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CC2D1A (NP_060191.3, 1 a.a. ~ 951 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54862

Enviar uma mensagem


CC2D1A purified MaxPab mouse polyclonal antibody (B01P)

CC2D1A purified MaxPab mouse polyclonal antibody (B01P)