BSPRY purified MaxPab mouse polyclonal antibody (B01P)
  • BSPRY purified MaxPab mouse polyclonal antibody (B01P)

BSPRY purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054836-B01P
BSPRY purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human BSPRY protein.
Información adicional
Size 50 ug
Gene Name BSPRY
Gene Alias FLJ20150
Gene Description B-box and SPRY domain containing
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSAEGAEPGPGSGSGPGPGPLCPEHGQALSWFCGSERRPVCAACAGLGGRCRGHRIRRAEERAEELRNKIVDQCERLQLQSAAITKYVADVLPGKNQRAVSMASAARELVIQRLSLVRSLCESEEQRLLEQVHGEEERAHQSILTQRVHWAEALQKLDTIRTGLVGMLTHLDDLQLIQKEQEIFERHRGHTDR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BSPRY (AAH01477.1, 1 a.a. ~ 193 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54836

Enviar uma mensagem


BSPRY purified MaxPab mouse polyclonal antibody (B01P)

BSPRY purified MaxPab mouse polyclonal antibody (B01P)