PC-LKC monoclonal antibody (M01), clone 1D2
  • PC-LKC monoclonal antibody (M01), clone 1D2

PC-LKC monoclonal antibody (M01), clone 1D2

Ref: AB-H00054825-M01
PC-LKC monoclonal antibody (M01), clone 1D2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCLKC.
Información adicional
Size 100 ug
Gene Name PCDH24
Gene Alias FLJ20124|FLJ20383|MGC163154|PC-LKC|PCLKC
Gene Description protocadherin 24
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GGMYHNTFTIQCSLPVFLSISVVDQPDLDPQFVREFYSASVAEDAAKGTSVLTVEAVDGDKGINDPVIYSISYSTRPGWFDIGADGVIRVNGSLDREQLLEADEEVQLQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PC-LKC (NP_060145, 210 a.a. ~ 318 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54825
Clone Number 1D2
Iso type IgG3 Kappa

Enviar uma mensagem


PC-LKC monoclonal antibody (M01), clone 1D2

PC-LKC monoclonal antibody (M01), clone 1D2