PC-LKC polyclonal antibody (A01)
  • PC-LKC polyclonal antibody (A01)

PC-LKC polyclonal antibody (A01)

Ref: AB-H00054825-A01
PC-LKC polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PC-LKC.
Información adicional
Size 50 uL
Gene Name PCDH24
Gene Alias FLJ20124|FLJ20383|MGC163154|PC-LKC|PCLKC
Gene Description protocadherin 24
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GGMYHNTFTIQCSLPVFLSISVVDQPDLDPQFVREFYSASVAEDAAKGTSVLTVEAVDGDKGINDPVIYSISYSTRPGWFDIGADGVIRVNGSLDREQLLEADEEVQLQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PC-LKC (NP_060145, 210 a.a. ~ 318 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54825

Enviar uma mensagem


PC-LKC polyclonal antibody (A01)

PC-LKC polyclonal antibody (A01)