ZNF280D purified MaxPab mouse polyclonal antibody (B01P)
  • ZNF280D purified MaxPab mouse polyclonal antibody (B01P)

ZNF280D purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054816-B01P
ZNF280D purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF280D protein.
Información adicional
Size 50 ug
Gene Name ZNF280D
Gene Alias MGC21637|MGC61687|SUHW4|ZNF634
Gene Description zinc finger protein 280D
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MGDNPFQPKSNSKMAELFMECEEEELEPWQKKVKEVEDDDDDEPIFVGEISSSKPAISNILNRVNPSSYSRGLKNGALSRGITAAFKPTSQHYTNPTSNPVPASPINFHPESRSSDSSVIVQPFSKPVSVSKTIRPAQGSIGCCLSISTVPSYNSGLS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF280D (NP_001002844.1, 1 a.a. ~ 158 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54816

Enviar uma mensagem


ZNF280D purified MaxPab mouse polyclonal antibody (B01P)

ZNF280D purified MaxPab mouse polyclonal antibody (B01P)