QPCTL purified MaxPab mouse polyclonal antibody (B01P)
  • QPCTL purified MaxPab mouse polyclonal antibody (B01P)

QPCTL purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054814-B01P
QPCTL purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human QPCTL protein.
Información adicional
Size 50 ug
Gene Name QPCTL
Gene Alias FLJ20084
Gene Description glutaminyl-peptide cyclotransferase-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen QPCTL (AAH11553, 1 a.a. ~ 288 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54814

Enviar uma mensagem


QPCTL purified MaxPab mouse polyclonal antibody (B01P)

QPCTL purified MaxPab mouse polyclonal antibody (B01P)