RNF111 monoclonal antibody (M05), clone 1C4
  • RNF111 monoclonal antibody (M05), clone 1C4

RNF111 monoclonal antibody (M05), clone 1C4

Ref: AB-H00054778-M05
RNF111 monoclonal antibody (M05), clone 1C4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RNF111.
Información adicional
Size 100 ug
Gene Name RNF111
Gene Alias ARK|DKFZp313E0731|DKFZp686H1966|DKFZp761D081|FLJ38008
Gene Description ring finger protein 111
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab,IF
Immunogen Prot. Seq MSQWTPEYNELYTLKVDMKSEIPSDAPKTQESLKGILLHPEPIGAAKSFPAGVEMINSKVGNEFSHLCDDSQKQEKEMNGNQQEQEKSLVVRKKRKSQQAGPSYVQNC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNF111 (NP_060080, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54778
Clone Number 1C4
Iso type IgG2a Kappa

Enviar uma mensagem


RNF111 monoclonal antibody (M05), clone 1C4

RNF111 monoclonal antibody (M05), clone 1C4