PCSK4 purified MaxPab mouse polyclonal antibody (B01P)
  • PCSK4 purified MaxPab mouse polyclonal antibody (B01P)

PCSK4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054760-B01P
PCSK4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PCSK4 protein.
Información adicional
Size 50 ug
Gene Name PCSK4
Gene Alias DKFZp434B217|MGC34749|PC4|SPC5
Gene Description proprotein convertase subtilisin/kexin type 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MGTRSTLVAIRPLDVSTEGYNNWVFMSTHFWDENPQGVWTLGLENKGYYFNTGTLYRYTLLLYGTAEDMTARPTGPQVTSSACVQRDTEGLCQACDGPAYILGQLCLAYCPPRFFNHTRLVTAGPGHTAAPALRVCSSCHASCYTCRGGSPRDCTSCPPSSTLDQQQGSCMGPTTPDSRPRLRAAACPHHRCPASAMVLSLLAVTLGGPVLCGMSMDLPLYAWLSRARATPTKPQVWLPAGT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PCSK4 (AAH36354, 1 a.a. ~ 242 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54760

Enviar uma mensagem


PCSK4 purified MaxPab mouse polyclonal antibody (B01P)

PCSK4 purified MaxPab mouse polyclonal antibody (B01P)