KLHDC4 purified MaxPab rabbit polyclonal antibody (D01P)
  • KLHDC4 purified MaxPab rabbit polyclonal antibody (D01P)

KLHDC4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00054758-D01P
KLHDC4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KLHDC4 protein.
Información adicional
Size 100 ug
Gene Name KLHDC4
Gene Alias DKFZp434G0522|FLJ00104
Gene Description kelch domain containing 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MGKKGKKEKKGRGAEKTAAKMEKKVSKRSRKEEEDLEALIAHFQTLDAKRTQTVELPCPPPSPRLNASLSVHPEKDELILFGGEYFNGQKTFLYNELYVYNTRKDTWTKVDIPSPPPRRCAHQAVVVPQGGGQLWVFGGEFASPNGEQFYHYKDLWVLHLATKTWEQVKSTGGPSGRSGHRMVAWKRQLILFGGFHESTRDYIYYNDVYAFNLDTFTWSKLSPSGTGPTPRSGCQMSVTPQGGIVVYGGYSKQRV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KLHDC4 (NP_060036.2, 1 a.a. ~ 520 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54758

Enviar uma mensagem


KLHDC4 purified MaxPab rabbit polyclonal antibody (D01P)

KLHDC4 purified MaxPab rabbit polyclonal antibody (D01P)