IL17RD polyclonal antibody (A01)
  • IL17RD polyclonal antibody (A01)

IL17RD polyclonal antibody (A01)

Ref: AB-H00054756-A01
IL17RD polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IL17RD.
Información adicional
Size 50 uL
Gene Name IL17RD
Gene Alias DKFZp434N1928|FLJ35755|IL-17RD|IL17RLM|MGC133309|SEF
Gene Description interleukin 17 receptor D
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MESQPFLNMKFETDYFVKVVPFPSIKNESNYHPFFFRTRACDLLLQPDNLACKPFWKPRNLNISQHGSDMQVSFDHAPHNFGFRFFYLHYKLKHEGPFKR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL17RD (NP_060033, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54756

Enviar uma mensagem


IL17RD polyclonal antibody (A01)

IL17RD polyclonal antibody (A01)