XAF1 purified MaxPab rabbit polyclonal antibody (D01P)
  • XAF1 purified MaxPab rabbit polyclonal antibody (D01P)

XAF1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00054739-D01P
XAF1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human XAF1 protein.
Información adicional
Size 100 ug
Gene Name XAF1
Gene Alias BIRC4BP|HSXIAPAF1|XIAPAF1
Gene Description XIAP associated factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MEGDFSVCRNCKRHVVSANFTLHEAYCLRFLVLCPECEEPVPKETMEEHCKLEHQQVGCTMCQQSMQKSSLEFHKANECQERPVECKFCKLDMQLSKLELHESYCGSRTELCQGCGQFIMHRMLAQHRDVCRSEQAQLGKGERISAPEREIYCHYCNQMIPENKYFHHMGKCCPDSEFKKHFPVGNPEILPSSLPSQAAENQTSTMEKDVRPKTRSINRFPLHSESSSKKAPRSKNKTLDPLLMSEPKPRTSSPR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen XAF1 (NP_059993.2, 1 a.a. ~ 301 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54739

Enviar uma mensagem


XAF1 purified MaxPab rabbit polyclonal antibody (D01P)

XAF1 purified MaxPab rabbit polyclonal antibody (D01P)