MARCH5 polyclonal antibody (A01)
  • MARCH5 polyclonal antibody (A01)

MARCH5 polyclonal antibody (A01)

Ref: AB-H00054708-A01
MARCH5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MARCH5.
Información adicional
Size 50 uL
Gene Name MARCH5
Gene Alias FLJ20445|MARCH-V|MITOL|RNF153
Gene Description membrane-associated ring finger (C3HC4) 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MPDQALQQMLDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVYVLDLADRLISK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MARCH5 (NP_060294.1, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54708

Enviar uma mensagem


MARCH5 polyclonal antibody (A01)

MARCH5 polyclonal antibody (A01)