CROT monoclonal antibody (M01), clone 1A6
  • CROT monoclonal antibody (M01), clone 1A6

CROT monoclonal antibody (M01), clone 1A6

Ref: AB-H00054677-M01
CROT monoclonal antibody (M01), clone 1A6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CROT.
Información adicional
Size 100 ug
Gene Name CROT
Gene Alias COT
Gene Description carnitine O-octanoyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq ENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWLEEWWLNVAYLDVRIPSQL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CROT (NP_066974, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54677
Clone Number 1A6
Iso type IgG1 Kappa

Enviar uma mensagem


CROT monoclonal antibody (M01), clone 1A6

CROT monoclonal antibody (M01), clone 1A6