UGT1A3 polyclonal antibody (A01)
  • UGT1A3 polyclonal antibody (A01)

UGT1A3 polyclonal antibody (A01)

Ref: AB-H00054659-A01
UGT1A3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UGT1A3.
Información adicional
Size 50 uL
Gene Name UGT1A3
Gene Alias UGT1C
Gene Description UDP glucuronosyltransferase 1 family, polypeptide A3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KVLVVPIDGSHWLSMREVLRELHARGHQAVVLTPEVNMHIKEENFFTLTTYAISWTQDEFDRHVLGHTQLYFETEHFLKKFFRSMAMLNNMSLVYHRSCV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UGT1A3 (NP_061966, 30 a.a. ~ 129 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54659

Enviar uma mensagem


UGT1A3 polyclonal antibody (A01)

UGT1A3 polyclonal antibody (A01)