DLL4 polyclonal antibody (A01)
  • DLL4 polyclonal antibody (A01)

DLL4 polyclonal antibody (A01)

Ref: AB-H00054567-A01
DLL4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DLL4.
Información adicional
Size 50 uL
Gene Name DLL4
Gene Alias MGC126344|hdelta2
Gene Description delta-like 4 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq HAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DLL4 (NP_061947, 123 a.a. ~ 221 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54567

Enviar uma mensagem


DLL4 polyclonal antibody (A01)

DLL4 polyclonal antibody (A01)