ING3 monoclonal antibody (M02), clone 2C4
  • ING3 monoclonal antibody (M02), clone 2C4

ING3 monoclonal antibody (M02), clone 2C4

Ref: AB-H00054556-M02
ING3 monoclonal antibody (M02), clone 2C4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ING3.
Información adicional
Size 100 ug
Gene Name ING3
Gene Alias Eaf4|FLJ20089|ING2|p47ING3
Gene Description inhibitor of growth family, member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLQHF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ING3 (NP_938008, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54556
Clone Number 2C4
Iso type IgG2b Kappa

Enviar uma mensagem


ING3 monoclonal antibody (M02), clone 2C4

ING3 monoclonal antibody (M02), clone 2C4