RNF186 polyclonal antibody (A01)
  • RNF186 polyclonal antibody (A01)

RNF186 polyclonal antibody (A01)

Ref: AB-H00054546-A01
RNF186 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RNF186.
Información adicional
Size 50 uL
Gene Name RNF186
Gene Alias FLJ20225|RP11-91K11.1
Gene Description ring finger protein 186
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DNTWSITCPLCRKVTAVPGGLICSLRDHEAVVGQLAQPCTEVSLCPQGLVDPADLAAGHPSLVGEDGQDEVSANHV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNF186 (NP_061935, 75 a.a. ~ 150 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54546

Enviar uma mensagem


RNF186 polyclonal antibody (A01)

RNF186 polyclonal antibody (A01)