NBLA00058 purified MaxPab mouse polyclonal antibody (B01P)
  • NBLA00058 purified MaxPab mouse polyclonal antibody (B01P)

NBLA00058 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054529-B01P
NBLA00058 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NBLA00058 protein.
Información adicional
Size 50 ug
Gene Name ASNSD1
Gene Alias FLJ20752|NBLA00058|NS3TP1
Gene Description asparagine synthetase domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MCGICCSVNFSAEHFSQDLKEDLLYNLKQRGPNSSKQLLKSDVNYQCLFSAHVLHLRGVLTTQPVEDERGNVFLWNGEIFSGIKVEAEENDTQILFNYLSSCKNESEILSLFSEVQGPWSFIYYQASSHYLWFGRDFFGRRSLLWHFSNLGKSFCLSSVGTQTSGLANQWQEVPASGLFRIDLKSTVISRCIILQLYPWKYISRENIIEENVNSLSQISADLPAFVSVVANEAKLYLEKPVVPLNMMLPQAALET
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NBLA00058 (NP_061921.1, 1 a.a. ~ 643 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54529

Enviar uma mensagem


NBLA00058 purified MaxPab mouse polyclonal antibody (B01P)

NBLA00058 purified MaxPab mouse polyclonal antibody (B01P)