CPVL polyclonal antibody (A01)
  • CPVL polyclonal antibody (A01)

CPVL polyclonal antibody (A01)

Ref: AB-H00054504-A01
CPVL polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant CPVL.
Información adicional
Size 50 uL
Gene Name CPVL
Gene Alias HVLP|MGC10029
Gene Description carboxypeptidase, vitellogenic-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MVGAMWKVIVSLVLLMPGPCDGLFRSLYRSVSMPPKGDSGQPLFLTPYIEAGKIQKGRELSLVGPFPGLNMKSYAGFLTVNKTYNSNLFFWFFPAQIQPEDAPVVLWLQGGPGGSSMFGLFVEHGPYVVTSNMTLRDRDFPWTTTLSMLYIDNPVGTGFSFTDDTHGYAVNEDDVARDLYSALIQFFQIFPEYKNNDFYVTGESYAGKYVPAIAHLIHSLNPVREVKINLNGIAIGDGYSDPESIIGGYAEFLYQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CPVL (AAH16838.1, 1 a.a. ~ 476 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54504

Enviar uma mensagem


CPVL polyclonal antibody (A01)

CPVL polyclonal antibody (A01)