CHPF2 purified MaxPab mouse polyclonal antibody (B01P)
  • CHPF2 purified MaxPab mouse polyclonal antibody (B01P)

CHPF2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054480-B01P
CHPF2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CHPF2 protein.
Información adicional
Size 50 ug
Gene Name CHPF2
Gene Alias ChSy-3|chPF-2|CSGlcAT|CSGLCA-T
Gene Description chondroitin polymerizing factor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRLSSLLALLRPALPLILGLSLGCSLSLLRVSWIQGEGEDPCVEAVGERGGPQNPDSRARLDQSDEDFKPRIVPYYRDPNKPYKKVLRTRYIQTELGSRERLLVAVLTSRATLSTLAVAVNRTVAHHFPRLLYFTGQRGARAPAGMQVVSHGDERPAWLMSETLRHLHTHFGADYDWFFIMQDDTYVQAPRLAALAGHLSINQDLYLGRAEEFIGAGEQARYCHGGFGYLLSRSLLLRLRPHLDGCRGDILSARP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CHPF2 (NP_061888.1, 1 a.a. ~ 772 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54480

Enviar uma mensagem


CHPF2 purified MaxPab mouse polyclonal antibody (B01P)

CHPF2 purified MaxPab mouse polyclonal antibody (B01P)