KRT20 purified MaxPab rabbit polyclonal antibody (D01P)
  • KRT20 purified MaxPab rabbit polyclonal antibody (D01P)

KRT20 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00054474-D01P
KRT20 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KRT20 protein.
Información adicional
Size 100 ug
Gene Name KRT20
Gene Alias CD20|CK20|K20|KRT21|MGC35423
Gene Description keratin 20
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLTGGGDLFVGNEKMAMQNLNDRLASYLEKVRTLEQSNSKLEVQIKQWYETNAPRAGRDYSAYYRQIEELRSQIKDAQLQNARCVLQIDNAKLAAEDFRLKYETERGIRLTVEADLQGLNKVFDDLTLHKTDLEIQIEELNKDLALLKKEHQEEVDGLHKHLGNTVNVEVDAAPGLNLGVIMNEMRQKYEVMAQKNLQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KRT20 (NP_061883.1, 1 a.a. ~ 424 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54474

Enviar uma mensagem


KRT20 purified MaxPab rabbit polyclonal antibody (D01P)

KRT20 purified MaxPab rabbit polyclonal antibody (D01P)