FAM134B purified MaxPab rabbit polyclonal antibody (D01P)
  • FAM134B purified MaxPab rabbit polyclonal antibody (D01P)

FAM134B purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00054463-D01P
FAM134B purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FAM134B protein.
Información adicional
Size 100 ug
Gene Name FAM134B
Gene Alias FLJ20152|FLJ22155|FLJ22179
Gene Description family with sequence similarity 134, member B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPEGEDFGPGKSWEVINSKPDERPRLSHCIAESWMNFSIFLQEMSLFKQQSPGKFCLLVCSVCTFFTILGSYIPGVILSYLLLLCAFLCPLFKCNDIGQKIYSKIKSVLLKLDFGIGEYINQKKRERSEADKEKSHKDDSELDFSALCPKISLTVAAKELSVSDTDVSEVSWTDNGTFNLSEGYTPQTDTSDDLDRPSEEVFSRDLSDFPSLENGMGTNDEDELSLGLPTELKRKKEQLDSGHRPSKETQSAAGL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FAM134B (NP_061873.2, 1 a.a. ~ 356 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54463

Enviar uma mensagem


FAM134B purified MaxPab rabbit polyclonal antibody (D01P)

FAM134B purified MaxPab rabbit polyclonal antibody (D01P)