FBXO42 purified MaxPab rabbit polyclonal antibody (D01P)
  • FBXO42 purified MaxPab rabbit polyclonal antibody (D01P)

FBXO42 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00054455-D01P
FBXO42 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FBXO42 protein.
Información adicional
Size 100 ug
Gene Name FBXO42
Gene Alias Fbx42|KIAA1332
Gene Description F-box protein 42
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MASSSDSEDDSFMAVDQEETVLEGTMDQDEEPHPVLEAEETRHNRSMSELPEEVLEYILSFLSPYQEHKTAALVCKQWYRLIKGVAHQCYHGFMKAVQEGNIQWESRTYPYPGTPITQRFSHSACYYDANQSMYVFGGCTQSSCNAAFNDLWRLDLNSKEWIRPLASGSYPSPKAGATLVVYKDLLVLFGGWTRPSPYPLHQPERFFDEIHTYSPSKNWWNCIVTTHGPPPMAGHSSCVIDDKMIVFGGSLGSRQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FBXO42 (AAH43410.1, 1 a.a. ~ 716 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54455

Enviar uma mensagem


FBXO42 purified MaxPab rabbit polyclonal antibody (D01P)

FBXO42 purified MaxPab rabbit polyclonal antibody (D01P)