SSH1 monoclonal antibody (M12), clone 2F9
  • SSH1 monoclonal antibody (M12), clone 2F9

SSH1 monoclonal antibody (M12), clone 2F9

Ref: AB-H00054434-M12
SSH1 monoclonal antibody (M12), clone 2F9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SSH1.
Información adicional
Size 100 ug
Gene Name SSH1
Gene Alias FLJ38102|KIAA1298|SSH-1
Gene Description slingshot homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PKSLLLKNSHCDKNPPSTEVVIKEESSPKKDMKPAKDLRLLFSNESEKPTTNSYLMQHQESIIQLQKAGLVRKHTKELERLKSVPADPAPPSRDGPAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SSH1 (NP_061857.2, 752 a.a. ~ 849 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54434
Clone Number 2F9
Iso type IgG2a Kappa

Enviar uma mensagem


SSH1 monoclonal antibody (M12), clone 2F9

SSH1 monoclonal antibody (M12), clone 2F9