SIAE purified MaxPab mouse polyclonal antibody (B01P)
  • SIAE purified MaxPab mouse polyclonal antibody (B01P)

SIAE purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054414-B01P
SIAE purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SIAE protein.
Información adicional
Size 50 ug
Gene Name SIAE
Gene Alias CSE-C|LSE|MGC87009|YSG2
Gene Description sialic acid acetylesterase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MVAPGLVLGLVLPLILWADRSAGIGFRFASYINNDMVLQKEPAGAVIWGFGTPGATVTVTLRQGQETIMKKVTSVKAHSDTWMVVLDPMKPGGPFEVMAQQTLEKINFTLRVHDVLFGDVWLCSGQSNMQMTVLQIFNATRELSNTAAYQSVRILSVSPIQAEQELEDLVAVDLQWSKPTSENLGHGYFKYMSAVCWLFGRHLYDTLQYPIGLIASSWGGTPIEAWSSGRSLKACGVPKQGSIPYDSVTGPSKHS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SIAE (NP_733746.1, 1 a.a. ~ 523 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54414

Enviar uma mensagem


SIAE purified MaxPab mouse polyclonal antibody (B01P)

SIAE purified MaxPab mouse polyclonal antibody (B01P)