NLGN3 purified MaxPab rabbit polyclonal antibody (D01P)
  • NLGN3 purified MaxPab rabbit polyclonal antibody (D01P)

NLGN3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00054413-D01P
NLGN3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NLGN3 protein.
Información adicional
Size 100 ug
Gene Name NLGN3
Gene Alias ASPGX1|AUTSX1|HNL3|KIAA1480
Gene Description neuroligin 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MWLRLGPPSLSLSPKPTVGRSLCLTLWFLSLALRASTQAPAPTVNTHFGKLRGARVPLPSEILGPVDQYLGVPYAAPPIGEKRFLPPEPPPYWSGIRNATHFPPVCPQNIHTAVPEVMLPVWFTANLDIVATYIQEPNEDCLYLNVYVPTEDGSGAKKQGEDLADNDGDEDEDIRDSGAKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITLNYRVGVLGFLSTGDQAAKGNYGLLDQIQALRWVSENIAFF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NLGN3 (AAH51715.1, 1 a.a. ~ 828 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54413

Enviar uma mensagem


NLGN3 purified MaxPab rabbit polyclonal antibody (D01P)

NLGN3 purified MaxPab rabbit polyclonal antibody (D01P)