CYTL1 polyclonal antibody (A02)
  • CYTL1 polyclonal antibody (A02)

CYTL1 polyclonal antibody (A02)

Ref: AB-H00054360-A02
CYTL1 polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant CYTL1.
Información adicional
Size 50 uL
Gene Name CYTL1
Gene Alias C17|C4orf4
Gene Description cytokine-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MRTPGPLPVLLLLLAGAPAARPTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTALPDRQR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CYTL1 (AAH31391, 1 a.a. ~ 136 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54360

Enviar uma mensagem


CYTL1 polyclonal antibody (A02)

CYTL1 polyclonal antibody (A02)