SOX18 monoclonal antibody (M01A), clone 2G12
  • SOX18 monoclonal antibody (M01A), clone 2G12

SOX18 monoclonal antibody (M01A), clone 2G12

Ref: AB-H00054345-M01A
SOX18 monoclonal antibody (M01A), clone 2G12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SOX18.
Información adicional
Size 200 uL
Gene Name SOX18
Gene Alias HLTS
Gene Description SRY (sex determining region Y)-box 18
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EPGRYGLSPAGRGERQAADESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNAAEKRPFVEEAERLRVQHLRDHP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SOX18 (NP_060889, 63 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 54345
Clone Number 2G12
Iso type IgG2a Kappa

Enviar uma mensagem


SOX18 monoclonal antibody (M01A), clone 2G12

SOX18 monoclonal antibody (M01A), clone 2G12