SOX18 polyclonal antibody (A01)
  • SOX18 polyclonal antibody (A01)

SOX18 polyclonal antibody (A01)

Ref: AB-H00054345-A01
SOX18 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SOX18.
Información adicional
Size 50 uL
Gene Name SOX18
Gene Alias HLTS
Gene Description SRY (sex determining region Y)-box 18
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EPGRYGLSPAGRGERQAADESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNAAEKRPFVEEAERLRVQHLRDHP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SOX18 (NP_060889, 63 a.a. ~ 150 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54345

Enviar uma mensagem


SOX18 polyclonal antibody (A01)

SOX18 polyclonal antibody (A01)