NANS purified MaxPab mouse polyclonal antibody (B01P)
  • NANS purified MaxPab mouse polyclonal antibody (B01P)

NANS purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054187-B01P
NANS purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NANS protein.
Información adicional
Size 50 ug
Gene Name NANS
Gene Alias SAS
Gene Description N-acetylneuraminic acid synthase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVALGAKVLERHITLDKTWKGSDHSASLE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NANS (NP_061819.2, 1 a.a. ~ 359 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54187

Enviar uma mensagem


NANS purified MaxPab mouse polyclonal antibody (B01P)

NANS purified MaxPab mouse polyclonal antibody (B01P)