DCUN1D1 monoclonal antibody (M01), clone 3D7
  • DCUN1D1 monoclonal antibody (M01), clone 3D7

DCUN1D1 monoclonal antibody (M01), clone 3D7

Ref: AB-H00054165-M01
DCUN1D1 monoclonal antibody (M01), clone 3D7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DCUN1D1.
Información adicional
Size 100 ug
Gene Name DCUN1D1
Gene Alias DCUN1L1|RP42|SCCRO|SCRO|Tes3
Gene Description DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA,IF
Immunogen Prot. Seq MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DCUN1D1 (NP_065691, 1 a.a. ~ 89 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54165
Clone Number 3D7
Iso type IgG2b Kappa

Enviar uma mensagem


DCUN1D1 monoclonal antibody (M01), clone 3D7

DCUN1D1 monoclonal antibody (M01), clone 3D7