RIPK4 monoclonal antibody (M04), clone 4H5
  • RIPK4 monoclonal antibody (M04), clone 4H5

RIPK4 monoclonal antibody (M04), clone 4H5

Ref: AB-H00054101-M04
RIPK4 monoclonal antibody (M04), clone 4H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RIPK4.
Información adicional
Size 100 ug
Gene Name RIPK4
Gene Alias ANKK2|ANKRD3|DIK|MGC129992|MGC129993|PKK|RIP4
Gene Description receptor-interacting serine-threonine kinase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq HLAARNGHLATVKLLVEEKADVLARGPLNQTALHLAAAHGHSEVVEELVSADVIDLFDEQGLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSKT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RIPK4 (NP_065690, 675 a.a. ~ 784 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54101
Clone Number 4H5
Iso type IgG3 Kappa

Enviar uma mensagem


RIPK4 monoclonal antibody (M04), clone 4H5

RIPK4 monoclonal antibody (M04), clone 4H5