RIPK4 monoclonal antibody (M01), clone 2G3 View larger

Mouse monoclonal antibody raised against a partial recombinant RIPK4.

AB-H00054101-M01

New product

RIPK4 monoclonal antibody (M01), clone 2G3

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name RIPK4
Gene Alias ANKK2|ANKRD3|DIK|MGC129992|MGC129993|PKK|RIP4
Gene Description receptor-interacting serine-threonine kinase 4
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq HLAARNGHLATVKLLVEEKADVLARGPLNQTALHLAAAHGHSEVVEELVSADVIDLFDEQGLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSKT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RIPK4 (NP_065690, 675 a.a. ~ 784 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54101
Clone Number 2G3
Iso type IgG1 Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant RIPK4.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant RIPK4.

Mouse monoclonal antibody raised against a partial recombinant RIPK4.