FAM3B purified MaxPab rabbit polyclonal antibody (D01P)
  • FAM3B purified MaxPab rabbit polyclonal antibody (D01P)

FAM3B purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00054097-D01P
FAM3B purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FAM3B protein.
Información adicional
Size 100 ug
Gene Name FAM3B
Gene Alias 2-21|C21orf11|C21orf76|ORF9|PANDER|PRED44
Gene Description family with sequence similarity 3, member B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FAM3B (NP_478066.3, 1 a.a. ~ 235 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54097

Enviar uma mensagem


FAM3B purified MaxPab rabbit polyclonal antibody (D01P)

FAM3B purified MaxPab rabbit polyclonal antibody (D01P)