CPSF2 polyclonal antibody (A01)
  • CPSF2 polyclonal antibody (A01)

CPSF2 polyclonal antibody (A01)

Ref: AB-H00053981-A01
CPSF2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CPSF2.
Información adicional
Size 50 uL
Gene Name CPSF2
Gene Alias CPSF100|KIAA1367
Gene Description cleavage and polyadenylation specific factor 2, 100kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq FGDDEKETGEESEIIPTLEPLPPHEVPGHQSVFMNEPRLSDFKQVLLREGIQAEFVGGVLVCNNQVAVRRTETGRIGLEGCLCQDFYRIRDLLYEQYAIV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CPSF2 (NP_059133, 683 a.a. ~ 782 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 53981

Enviar uma mensagem


CPSF2 polyclonal antibody (A01)

CPSF2 polyclonal antibody (A01)