View larger
Mouse monoclonal antibody raised against a partial recombinant CSNK1G1.
AB-H00053944-M02
New product
CSNK1G1 monoclonal antibody (M02), clone 2E10
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | CSNK1G1 |
| Gene Alias | - |
| Gene Description | casein kinase 1, gamma 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA |
| Immunogen Prot. Seq | KKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEAKCCCFFKRKRKKT |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | CSNK1G1 (AAH17236, 293 a.a. ~ 393 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 53944 |
| Clone Number | 2E10 |
| Iso type | IgG3 Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant CSNK1G1.