PELO monoclonal antibody (M03), clone 2C2
  • PELO monoclonal antibody (M03), clone 2C2

PELO monoclonal antibody (M03), clone 2C2

Ref: AB-H00053918-M03
PELO monoclonal antibody (M03), clone 2C2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PELO.
Información adicional
Size 100 ug
Gene Name PELO
Gene Alias CGI-17|PRO1770
Gene Description pelota homolog (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq RAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEED
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PELO (NP_057030.3, 291 a.a. ~ 385 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 53918
Clone Number 2C2
Iso type IgG2a Kappa

Enviar uma mensagem


PELO monoclonal antibody (M03), clone 2C2

PELO monoclonal antibody (M03), clone 2C2