MYO3A monoclonal antibody (M03), clone 5A12
  • MYO3A monoclonal antibody (M03), clone 5A12

MYO3A monoclonal antibody (M03), clone 5A12

Ref: AB-H00053904-M03
MYO3A monoclonal antibody (M03), clone 5A12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MYO3A.
Información adicional
Size 50 ug
Gene Name MYO3A
Gene Alias DFNB30
Gene Description myosin IIIA
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq HEEINNIKKKDNKDSKATSEREACGLAIFSKQISKLSEEYFILQKKLNEMILSQQLKSLYLGVSHHKPINRRVSSQQCLSGVCKGEEPKIL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MYO3A (NP_059129, 1400 a.a. ~ 1490 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 53904
Clone Number 5A12
Iso type IgG2a Kappa

Enviar uma mensagem


MYO3A monoclonal antibody (M03), clone 5A12

MYO3A monoclonal antibody (M03), clone 5A12