MYO3A polyclonal antibody (A01)
  • MYO3A polyclonal antibody (A01)

MYO3A polyclonal antibody (A01)

Ref: AB-H00053904-A01
MYO3A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MYO3A.
Información adicional
Size 50 uL
Gene Name MYO3A
Gene Alias DFNB30
Gene Description myosin IIIA
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq HEEINNIKKKDNKDSKATSEREACGLAIFSKQISKLSEEYFILQKKLNEMILSQQLKSLYLGVSHHKPINRRVSSQQCLSGVCKGEEPKIL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MYO3A (NP_059129, 1400 a.a. ~ 1490 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 53904

Enviar uma mensagem


MYO3A polyclonal antibody (A01)

MYO3A polyclonal antibody (A01)